Menú
Recombinant PDGF Porcine
For research use only
Description
Platelet-derived growth factor, known as PDGF, is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle & connective tissue. It plays a key role in embryonic development, cell proliferation, cell migration, and angiogenesis.
Porcine PDGF consists primarily of PDGF homodimers and it has approximately 70-80% homology with the B-chain of human PDGF. Human and porcine PDGF bind to the same receptors and produce the same spectrum of biological effects.
Product information
Our recombinant porcine PDGF growth factor is produced in non-GMO insects, specifically in Trichoplusia ni (cabbage moth) with the Baculovirus Expression Vector System (BEVS).
Porcine PDGF-BB recombinant protein is a dimeric peptide of 108 amino acid residues.
SLGSPTVAEPAVIAECKTRTEVFEISRSLIDPTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKCETVVARPVT
Phosphate 20mM; NaCl 500mM; Tween20 0.05%; pH 7.4
> 80% measured by SDS page, and resolved under reduced (R) and non-reduced (NR) conditions. Higher purity available upon request.
ED50 < 5 ng/ml determined by the PDGF-BB dose dependent cellular proliferation of INHDF-NucLightRed cells via fluorescence assay determination. Determine the optimal concentration for each specific application using an initial dose response assay.
25.6 kDa
Liquid Frozen, contact us for lyophilized product.
Related products
