Recombinant FGF-2 Bovine
For research use only
For orders above 1 gram please contact us
Description
Basic Fibroblast Growth Factor, known as FGF basic or FGF-2, is a member of the fibroblast growth factor FGF family.
FGF-2 controls fundamental biological processes, including cell growth and differentiation, tissue formation, tissue repair and angiogenesis. It is commonly used as an ingredient for serum-free culture media for cultivated meat, cell culture applications, and as well, for veterinary research applications.
Product information
Our recombinant bovine FGF-2 growth factor is produced in non-GMO insects, specifically in Trichoplusia ni (cabbage moth) with the Baculovirus Expression Vector System (BEVS).
Bovine FGF-2 recombinant protein is a monomeric peptide of 155 amino acid residues.
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGR
LLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Phosphate 20mM; NaCl 500mM; Tween20 0.05%; pH 7.5
> 80% measured by SDS page, and resolved under reduced (R) and non-reduced (NR) conditions. Higher purity available upon request.
ED50 <5 ng/ml in cellular/luciferase assays determined by the FGF2 dose dependent activation of the EF-1α promoter in 2 INDFH-NucRedLight cells. Determine the optimal concentration for each specific application using an initial dose response assay
18.5 kDa
Liquid Frozen, contact us for lyophilized product.
Related products